Recombinant Adiponectin/Acrp30, Human - BK0296
Recombinant Adiponectin/Acrp30, Human Catalogue Numbers: BK0296-10, BK0296-50 Sizes: 10μg, 50μg Source: HEK 293 Molecular Weight: 16~17 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE. Biological Activity: ED50 < 2 μg/ml, measured in a cell proliferation assay using M1 cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHIt VYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human Adipolean/gArcp30 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adipolean/gArcp30 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by