Recombinant Human Fibroblast Growth Factor - acidic (rHuaFGF ) - PR1030
Recombinant Human Fibroblast Growth Factor- acidic (rHuaFGF) Catalogue Numbers: PR1030-10, PR1030-50, PR1030-1000 Sizes: 10µg, 50µg, 1.0mg (contact us for the 1.0mg option) Source: Escherichia coli Molecular Weight: Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 140 amino acids. Purity: >95% by SDS-PAGE and HPLC analyses. Biological Activity: Fully biologically active when compared to standard. The ED50, calculated by the dose-dependant proliferation of BAF3 cells expressing FGF receptors (measured by 3H-thymidine uptake) is less than 10 ng/ml, corresponding to a specific activity of ≥ 1×105 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. AA Sequence: MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D Endotoxin: Less than 1EU/