Recombinant IL-10, Rat (CHO-expressed) - BK0227

Recombinant IL-10, Rat (CHO-expressed) - BK0227

$183.53
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant IL-10, Rat(CHO-expre Ssed) Catalogue Numbers: BK0227-10, BK0227-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 8-22 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 <8μg /ml, measured in a bioassay using C6 cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQA ENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant rat Interleukin-10(IL-10) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by

Show More Show Less

Price History

$156 $183.53 (+$27.53)