Recombinant Shh, Mouse (CHO-expre Ssed) - BK0284
Recombinant Shh, Mouse (CHO-expre Ssed) Catalogue Numbers: BK0284-10, BK0284-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 20 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 1 µg/ml, measured by its ability to induce alkaline phosphatase production by CCL-226 cells, corresponding to a specific activity of >1 x 10ˆ3 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCK DKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHC SVKAENSVAAKSGG Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Murine Sonic Hedgehog (SHH) remains stable up to 6 months at -80°C from date of receipt. Upon recon