Biotinylated Recombinant Chicken Lysozyme G, Biotinylated Protein (MBP&His-Avi)
Product Overview Description Biotinylated Recombinant Chicken Lysozyme G, Biotinylated Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P27042 Target Symbol P27042 Species Gallus gallus (Chicken) Expression System E.coli Tag N-MBP&C-6His-Avi Target Protein Sequence GTGCYGSVSRIDTTGASCRTAKPEGLSYCGVRASRTIAERDLGSMNKYKVLIKRVGEALCIEPAVIAGIISRESHAGKILKNGWGDRGNGFGLMQVDKRYHKIEGTWNGEAHIRQGTRILIDMVKKIQRKFPRWTRDQQLKGGISAYNAGVGNVRSYERMDIGTLHDDYSNDVVARAQYFKQHGY Expression Range 27-211aa Protein Length Full Length of Mature Protein Mol. Weight 68.3 kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vi