
Biotinylated Recombinant E.Coli O6:H1 Upf0304 Protein Yfbu (YFBU) Protein (MBP&His-Avi)
Product Overview Description Biotinylated Recombinant E.Coli O6:H1 Upf0304 Protein Yfbu (YFBU) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P0A8W9 Target Symbol YFBU Species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) Expression System E.coli Tag N-MBP&C-6His-Avi Target Protein Sequence MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA Expression Range 1-164aa Protein Length Full Length Mol. Weight 67.3 kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the