Biotinylated Recombinant Human Blood group Rh (RHD) Protein (MBP&His-Avi)

Product Overview Description Biotinylated Recombinant Human Blood group Rh (RHD) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb Q02161 Target Symbol RHD Synonyms (RHXIII)(Rh polypeptide 2)(RhPII)(Rhesus D antigen)(CD antigen CD240D) Species Homo sapiens (Human) Expression System E.coli Tag N-MBP&C-6His-Avi Target Protein Sequence LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF Expression Range 388-417aa Protein Length Partial Mol. Weight 51.4 kDa Research Area Cardiovascular Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile wa