Biotinylated Recombinant Human Delta-Like Protein 3 (DLL3) Protein (MBP&His)

Biotinylated Recombinant Human Delta-Like Protein 3 (DLL3) Protein (MBP&His)

$684.00
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Biotinylated Recombinant Human Delta-Like Protein 3 (DLL3) Protein (MBP&His) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 90% as determined by SDS-PAGE. Activity Not tested. Uniprotkb Q9NYJ7 Target Symbol DLL3 Synonyms (Drosophila Delta homolog 3)(Delta3) Species Homo sapiens (Human) Expression System E.coli Tag N-MBP&C-6His Target Protein Sequence RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL Expression Range 429-492aa Protein Length Partial Mol. Weight 54.4 kDa Research Area Developmental Biology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute p

Show More Show Less