Recombinant Bovine Coronavirus Protein I (N) Protein (His)

Recombinant Bovine Coronavirus Protein I (N) Protein (His)

$418.40

Product Overview Description Recombinant Bovine Coronavirus Protein I (N) Protein (His) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb Q9QAQ4 Target Symbol N Synonyms Accessory protein N2;N internal ORF protein;IORF;Protein in nucleocapsid ORF Species Bovine coronavirus (strain OK-0514) (BCoV) (BCV) Expression System E.coli Tag C-6His Target Protein Sequence MASLSGPISPTNLEMFKPGVEELNPSKLLLLSNHQEGMLYPTILGSLELLSFKRERSLNLQRDKVCLLHQESQLLKLRGTGTDTTDVPLKQPMATSVNCCHDGIFTILEQDRMPKTSMAPTLTESSGSLVTRLMSIPRLTFSIGTQVAMRLFRLGFRLARYSLRVTILKAQEGLLLIPDLLHAHPVEPLVQDRAVEPILAIEPLPLV Expression Range 1-208aa Protein Length Full Length Mol. Weight 25.3 kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Target Details Target Function Structural protein that is not essential for the viral replication either in tissue culture or in its natural host. Subcellular Location Virion. Protein Families Coronavirus I protein family

Show More Show Less