Recombinant Bovine Protein S100-B (S100B) Protein (His-Avi)

Product Overview Description Recombinant Bovine Protein S100-B (S100B) Protein (His-Avi) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P02638 Target Symbol S100B Species Bos taurus (Bovine) Expression System E.coli Tag N-6His-Avi Target Protein Sequence SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE Expression Range 2-92aa Protein Length Full Length of Mature Protein Mol. Weight 13.3 kDa Research Area Cell Biology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.