Recombinant Dog Interleukin-33 (IL33) Protein (His)

Product Overview Description Recombinant Dog Interleukin-33 (IL33) Protein (His) is produced by our Yeast expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb O97863 Target Symbol IL33 Species Canis lupus familiaris (Dog) (Canis familiaris) Expression System Yeast Tag N-6His Target Protein Sequence CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS Expression Range 102-263aa Protein Length Partial Mol. Weight 19.5 kDa Research Area Cardiovascular Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconsti