Recombinant Dog Interleukin-4 (IL4) Protein (His)

Recombinant Dog Interleukin-4 (IL4) Protein (His)

$680.80
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Dog Interleukin-4 (IL4) Protein (His) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb O77762 Target Symbol IL4 Synonyms IL4Interleukin-4; IL-4; B-cell stimulatory factor 1; BSF-1; Lymphocyte stimulatory factor 1 Species Canis lupus familiaris (Dog) (Canis familiaris) Expression System E.coli Tag N-6His Target Protein Sequence HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH Expression Range 25-132aa Protein Length Full Length of Mature Protein Mol. Weight 16.8kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial

Show More Show Less