Recombinant Dog Interleukin-8 (CXCL8) Protein (GST)

Product Overview Description Recombinant Dog Interleukin-8 (CXCL8) Protein (GST) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P41324 Target Symbol CXCL8 Synonyms CXCL8; IL8; Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8 Species Canis lupus familiaris (Dog) (Canis familiaris) Expression System E.coli Tag N-GST Target Protein Sequence AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP Expression Range 23-101aa Protein Length Full Length of Mature Protein Mol. Weight 36.1kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring