Recombinant Epstein-Barr Virus Envelope Glycoprotein L (GL) Protein (His-SUMO)
Product Overview Description Recombinant Epstein-Barr Virus Envelope Glycoprotein L (GL) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P03212 Target Symbol GL Synonyms gL; BKRF2Envelope glycoprotein L; gL Species Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Expression System E.coli Tag N-6His-SUMO Target Protein Sequence NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG Expression Range 23-137aa Protein Length Full Length of Mature Protein Mol. Weight 28.7kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the via