Recombinant Horse Serum Amyloid A Protein (SAA1) Protein (His)

Product Overview Description Recombinant Horse Serum Amyloid A Protein (SAA1) Protein (His) is produced by our Yeast expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P19857 Target Symbol SAA1 Synonyms SAA1; Serum amyloid A protein; SAA) [Cleaved into: Amyloid protein A; Amyloid fibril protein AA)] Species Equus caballus (Horse) Expression System Yeast Tag N-6His Target Protein Sequence LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY Expression Range 1-110aa Protein Length Full Length Mol. Weight 14.3 kDa Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the