Recombinant Human Apolipoprotein A-Ii (APOA2) Protein (His-SUMO)

Product Overview Description Recombinant Human Apolipoprotein A-Ii (APOA2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P02652 Target Symbol APOA2 Species Homo sapiens (Human) Expression System E.coli Tag N-6His-SUMO Target Protein Sequence QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ Expression Range 24-100aa Protein Length Full Length of Mature Protein Mol. Weight 21.7 kDa Research Area Cancer Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL