Recombinant Human C-C Motif Chemokine 16 (CCL16) Protein (His-HA)

Product Overview Description Recombinant Human C-C Motif Chemokine 16 (CCL16) Protein (His-HA) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb O15467 Target Symbol CCL16 Synonyms Chemokine CC-4 ;HCC-4;Chemokine LEC;IL-10-inducible chemokine;LCC-1;Liver-expressed chemokineLymphocyte and monocyte chemoattractant ;LMCMonotactin-1 ;MTN-1NCC-4;Small-inducible cytokine A16 Species Homo sapiens (Human) Expression System E.coli Tag N-10His-HA Target Protein Sequence QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ Expression Range 24-120aa Protein Length Full Length of Mature Protein Mol. Weight 13.8 kDa Research Area Immunology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tr