
Recombinant Human Cathepsin O (CTSO) Protein (MBP&His)
Product Overview Description Recombinant Human Cathepsin O (CTSO) Protein (MBP&His) is produced by our Baculovirus expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P43234 Target Symbol CTSO Synonyms Cathepsin O; CATO_HUMAN; Ctso; CTSO1 Species Homo sapiens (Human) Expression System Baculovirus Tag N-MBP&C-6His Target Protein Sequence LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV Expression Range 108-321aa Protein Length Full Length of Mature Protein Mol. Weight 67.5 kDa Research Area Cell Biology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Target Details Target Function Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Subcellular Location Lysosome. Protein Families Peptidase C1 family Database References HGNC: 2542 OMIM: 600550 KEGG: hsa:1519 STRING: 9606.ENSP00000414904 UniGene: Hs.75262 Tissue Specificity Expressed in all tissues examined. High levels seen in the ovary, kidney and placenta while low levels seen in thymus and skeletal muscle. Gene Functions References We report that CTSO reduces the protein levels of BRCA1 and ZNF423 through cysteine proteinase-mediated degradation. We also have identified a series of transcription factors of BRCA1 that are regulated by CTSO at the protein level. PMID: 28968398 a single-nucleotide polymorphism near the CTSO gene is a poor prognostic factor in breast cancer although further research might help to reveal the factors linking this genotype and prognosis. PMID: 26482374