Recombinant Human Fc Receptor-Like Protein 6 (FCRL6) Protein (His)

Product Overview Description Recombinant Human Fc Receptor-Like Protein 6 (FCRL6) Protein (His) is produced by our Baculovirus expression system. This is a extracellular protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb Q6DN72 Target Symbol FCRL6 Synonyms Fc receptor homolog 6; Fc receptor-like 6; Fc receptor-like protein 6; Fc receptor-like protein 7; FcR-like protein 6; FcRH6; FcRL6; FCRL6_HUMAN; FLJ16056; IFGP6; IgSF type I transmembrane receptor; leukocyte receptor Species Homo sapiens (Human) Expression System Baculovirus Tag N-10His Target Protein Sequence LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW Expression Range 20-307aa Protein Length Extracellular Domain Mol. Weight 34.2 kDa Research Area Immunology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Target Details Target Function Acts as a MHC class II receptor. When stimulated on its own, does not play a role in cytokine production or the release of cytotoxic granules by NK cells and cytotoxic CD8(+) T cells. Does not act as an Fc receptor. Subcellular Location Cell membrane; Single-pass type I membrane protein. Database References HGNC: 31910 OMIM: 613562 KEGG: hsa:343413 UniGene: Hs.196955 Tissue Specificity Expressed by cytolytic cells including NK cells, effector and effector-memory CD8(+) T-cells, and a subset of NKT cells (at protein level). Also expressed in gamma delta T cells and in a rare subset of effector CD4(+) T-cells (at protein level). Expressed Gene Functions References Human FCRL6 receptor, selectively expressed by cytotoxic T and natural killer (NK) cells, directly binds the major histocompatibility complex (MHC) class II molecule HLA-DR. PMID: 20519654 FCRL6 is a distinct indicator of cytotoxic effector lymphocytes that is upregulated in diseases characterized by chronic immune stimulation. PMID: 18991291