Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 (LILRB2) Protein (His&Myc)

Product Overview Description Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 (LILRB2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Activity Not tested. Uniprotkb Q8N423 Target Symbol LILRB2 Synonyms (LIR-2)(Leukocyte immunoglobulin-like receptor 2)(CD85 antigen-like family member D)(Immunoglobulin-like transcript 4)(ILT-4)(Monocyte/macrophage immunoglobulin-like receptor 10)(MIR-10)(CD antigen CD85d) Species Homo sapiens (Human) Expression System E.coli Tag N-10His&C-Myc Target Protein Sequence QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGV Expression Range 22-460aa Protein Length Partial Mol. Weight 55.1 kDa Research Area Immunology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Target Details Target Function Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G and HLA-F alleles. Involved in the down-regulation of the immune response and the development of tolerance. Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide (peptide-bound HLA-G-B2M) triggering differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance. Competes with CD8A for binding to class I MHC antigens. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions. Subcellular Location Cell membrane; Single-pass type I membrane protein. Database References HGNC: 6606 OMIM: 604815 STRING: 9606.ENSP00000375629 UniGene: Hs.655652 Tissue Specificity Expressed in monocytes and at lower levels in myeloid and plasmacytoid dendritic cells. Expressed in tolerogenic IL10-producing dendritic cells. Expressed in myeloid-derived suppressor cells during pregnancy. Detected at low levels in natural killer (NK)