Recombinant Human Metapneumovirus Fusion Glycoprotein F0 (F) Protein (His)

Product Overview Description Recombinant Human Metapneumovirus Fusion Glycoprotein F0 (F) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb Q6WB98 Target Symbol F Species Human metapneumovirus (strain CAN97-83) (HMPV) Expression System Baculovirus Tag C-6His Target Protein Sequence KESYLEESCSTITEGYLSVLRTGWYTNVFTLEVGDVENLTCSDGPSLIKTELDLTKSALRELKTVSADQLAREEQIENPRQSR Expression Range 20-102aa Protein Length Partial Mol. Weight 12.2 kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentratio