Recombinant Human Sars Coronavirus Spike Glycoprotein (S) Protein (His&Myc), Active

Recombinant Human Sars Coronavirus Spike Glycoprotein (S) Protein (His&Myc), Active

$693.60
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Human Sars Coronavirus Spike Glycoprotein (S) Protein (His&Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. Purity Greater than 95% as determined by SDS-PAGE. Endotoxin Less than 1.0 EU/ug as determined by LAL method. Activity 1. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2 , the EC 50 is 5.056-7.559 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2 , the EC 50 is 7.941-10.49 ng/ml. Uniprotkb P59594 Target Symbol S Synonyms (S glycoprotein)(E2)(Peplomer protein)(Spike protein S1)(Spike protein S2) Species Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus) Expression System Mammalian cell Tag N-10His&C-Myc Target Protein Sequence RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVAD

Show More Show Less