Recombinant Human Slam Family Member 6 (SLAMF6) Protein (hFc-Flag)

Product Overview Description Recombinant Human Slam Family Member 6 (SLAMF6) Protein (hFc-Flag) is produced by our Mammalian cell expression system. This is a protein fragment. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb Q96DU3 Target Symbol SLAMF6 Species Homo sapiens (Human) Expression System Mammalian cell Tag C-hFc-Flag Target Protein Sequence QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM Expression Range 22-226aa Protein Length Partial Mol. Weight 51.8 kDa Research Area Immunology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to ope