Recombinant Mouse Alpha-2-Macroglobulin Receptor-Associated Protein (LRPAP1) Protein (His&Myc)
Product Overview Description Recombinant Mouse Alpha-2-Macroglobulin Receptor-Associated Protein (LRPAP1) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P55302 Target Symbol LRPAP1 Synonyms Heparin-binding protein 44 Species Mus musculus (Mouse) Expression System Mammalian cell Tag N-10His&C-Myc Target Protein Sequence GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL Expression Range 248-360aa Protein Length Partial Mol. Weight 19.4 kDa Research Area Cardiovascular Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to br