Recombinant Mouse C-C Motif Chemokine 3 (CCL3) Protein (His)
Product Overview Description Recombinant Mouse C-C Motif Chemokine 3 (CCL3) Protein (His) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P10855 Target Symbol CCL3 Synonyms Ccl3; Mip1a; Scya3C-C motif chemokine 3; Heparin-binding chemotaxis protein; L2G25B; Macrophage inflammatory protein 1-alpha; MIP-1-alpha; SIS-alpha; Small-inducible cytokine A3; TY-5 Species Mus musculus (Mouse) Expression System E.coli Tag N-6His Target Protein Sequence APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA Expression Range 24-92aa Protein Length Full Length of Mature Protein Mol. Weight 11.9kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Recons