Recombinant Mouse Cell Adhesion Molecule 1 (CDCP1) Protein (His), Active

Recombinant Mouse Cell Adhesion Molecule 1 (CDCP1) Protein (His), Active

$568.80
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Mouse Cell Adhesion Molecule 1 (CDCP1) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. Purity Greater than 95% as determined by SDS-PAGE. Endotoxin Less than 1.0 EU/ug as determined by LAL method. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Cdcp1 at 2 μg/mL can bind Anti-CDCP1 recombinant antibody , the EC50 is 0.6397-0.8369 ng/ml. Uniprotkb Q5U462 Target Symbol CDCP1 Synonyms CUB domain-containing protein 1;Membrane glycoprotein gp140;Transmembrane and associated with src kinases;CD318;Cdcp1 Species Mus musculus (Mouse) Expression System Mammalian cell Tag C-10His Target Protein Sequence SEIALPQRSGVTVSIKLGNPALPVKICYIVMSRQHITELIIRPGERKSFTFSCSNPEKHFVLKIEKNIDCMSGPCPFGEVHLQPSTSELPILNRTFIWDVRAHKSIGLELQFATPRLRQIGPGESCADGVTHSISGHIDATEVRIGTFCSNGTVSRIKMQEGVKMALHLPWFHRRNVSGFSIANRSSIKRLCIIESVFEGEGSATLMSANYPGGFPEDELMTWQFVVP

Show More Show Less