Recombinant Mouse Cmrf35-Like Molecule 6 (CD300C) Protein (GST)

Recombinant Mouse Cmrf35-Like Molecule 6 (CD300C) Protein (GST)

$469.60
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Mouse Cmrf35-Like Molecule 6 (CD300C) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb A2A7V7 Target Symbol CD300C Synonyms (CLM-6)(CD300 antigen-like family member C)(CD antigen CD300c) Species Mus musculus (Mouse) Expression System E.coli Tag N-GST Target Protein Sequence HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPH Expression Range 22-188aa Protein Length Partial Mol. Weight 45.8 kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prio

Show More Show Less