Recombinant Mouse Elastin (ELN) Protein (His)

Product Overview Description Recombinant Mouse Elastin (ELN) Protein (His) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P54320 Target Symbol ELN Synonyms ElnElastin; Tropoelastin Species Mus musculus (Mouse) Expression System E.coli Tag N-10His Target Protein Sequence PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG Expression Range 266-443aa Protein Length Partial Mol. Weight 21.3 kDa Research Area Cardiovascular Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to