Recombinant Rabbit Apolipoprotein E (APOE) Protein (His&Myc)

Recombinant Rabbit Apolipoprotein E (APOE) Protein (His&Myc)

$680.80
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Rabbit Apolipoprotein E (APOE) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P18287 Target Symbol APOE Synonyms APOEApolipoprotein E; Apo-E Species Oryctolagus cuniculus (Rabbit) Expression System E.coli Tag N-10His&C-Myc Target Protein Sequence TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ Expression Range 20-311aa Protein Length Partial Mol. Weight 38.6kDa Research Area Cardiovascular Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer be

Show More Show Less