Recombinant Rabies Virus Matrix Protein (M) Protein (His)

Recombinant Rabies Virus Matrix Protein (M) Protein (His)

$680.80
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Rabies Virus Matrix Protein (M) Protein (His) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P15200 Target Symbol M Species Rabies virus (strain PM1503/AVO1) (RABV) Expression System E.coli Tag N-10His Target Protein Sequence MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE Expression Range 1-202aa Protein Length Full Length Mol. Weight 29.3 kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring

Show More Show Less