Recombinant Rat Beta-Nerve Growth Factor (NGF) Protein (His)

Product Overview Description Recombinant Rat Beta-Nerve Growth Factor (NGF) Protein (His) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P25427 Target Symbol NGF Synonyms Ngf; Ngfb; Beta-nerve growth factor; Beta-NGF Species Rattus norvegicus (Rat) Expression System E.coli Tag N-6His Target Protein Sequence THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG Expression Range 124-241aa Protein Length Partial Mol. Weight 17.2kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute prote