Recombinant Rat Sclerostin (SOST) Protein (hFc)
Product Overview Description Recombinant Rat Sclerostin (SOST) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb Q99P67 Target Symbol SOST Species Rattus norvegicus (Rat) Expression System Mammalian cell Tag C-hFc Target Protein Sequence FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY Expression Range 29-213aa Protein Length Full Length of Mature Protein Mol. Weight 50 kDa Research Area Signal Transduction Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bri