Recombinant Salmonella Typhi Universal Stress Protein A (USPA) Protein (His)

Product Overview Description Recombinant Salmonella Typhi Universal Stress Protein A (USPA) Protein (His) is produced by our Yeast expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb Q8Z268 Target Symbol USPA Synonyms uspA; STY4212; t3925; Universal stress protein A Species Salmonella typhi Expression System Yeast Tag N-6His Target Protein Sequence AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE Expression Range 2-144aa Protein Length Full Length of Mature Protein Mol. Weight 17.9kDa Research Area Microbiology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior t