Recombinant Universal Stress Protein A (USPA) Protein (His-Myc)

Product Overview Description Recombinant Universal Stress Protein A (USPA) Protein (His-Myc) is produced by our Mammalian cell expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb Q8Z268 Target Symbol USPA Synonyms uspA; STY4212; t3925; Universal stress protein A Species Salmonella typhi Expression System Mammalian cell Tag N-6His-Myc Target Protein Sequence AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE Expression Range 2-144aa Protein Length Full Length of Mature Protein Mol. Weight 19.9 kDa Research Area Microbiology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage 1. Store at -20°C/-80°C upon rece