Recombinant Zebrafish Erythropoietin (EPO) Protein (His)

Product Overview Description Recombinant Zebrafish Erythropoietin (EPO) Protein (His) is produced by our Yeast expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb Q2XNF5 Target Symbol EPO Synonyms epo; Erythropoietin; Erythropoietin-L2 Species Danio rerio (Zebrafish) (Brachydanio rerio) Expression System Yeast Tag N-6His Target Protein Sequence SPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS Expression Range 24-183aa Protein Length Full Length of Mature Protein Mol. Weight 19.8 Research Area Cardiovascular Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage 1. Store at -20°C/-80°C upon r