Recombinant Betacellulin, Human - BK0298

Recombinant Betacellulin, Human Catalogue Numbers: BK0298-10, BK0298-50 Sizes: 10μg, 50μg Source: HEK 293 Molecular Weight: 15~18 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE. Biological Activity: ED50 < 4 pg/ml, measured in a cell proliferation assay using 3T3 cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human Betacellulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Betacellulin should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For