Recombinant Betacellulin, Mouse (HEK293-expressed) - BK0299

Recombinant Betacellulin, Mouse (HEK293-expressed) - BK0299

$155.29
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant Betacellulin, Mouse (HEK293-expre Ssed) Catalogue Numbers: BK0299-10, BK0299-50 Sizes: 10μg, 50μg Source: HEK 293 Molecular Weight: 19-24 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 <0.08ng/ml, measured in a cell proliferation assay using 3T3 cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant murine Betacellulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Betacellulin should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for research, laboratory or

Show More Show Less

Price History

$132 $155.29 (+$23.29)