Recombinant IL-5, Mouse (CHO-expressed) - BK0250

Recombinant IL-5, Mouse (CHO-expre Ssed) Catalogue Numbers: BK0250-10, BK0250-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 25-40 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 0.5 ng/ml, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 2×10ˆ6 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: MEIPMSt VVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQt VRGGt VEMLFQNLSLIKKYIDRQ KEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Murine Interlerkin 5 (IL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.