Recombinant M-CSF, Human (CHO-expressed) - BK0267
Recombinant M-CSF, Human (CHO-expre Ssed) Catalogue Numbers: BK0267-10, BK0267-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 32-40 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50< 5 ng/ml, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 2×10ˆ5 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQL QELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS Endotoxin: <0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant human Macrophage-Colony Stimulating Factor (rhM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstituti