Recombinant MIP-1α/CCL3, Human (CHO-expressed) - BK0270
Recombinant MIP-1α/CCL3, Human (CHO-expre Ssed) Catalogue Numbers: BK0270-10, BK0270-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 8-10 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 100 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells expressing CCR5. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human MIP-1 Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1 Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for research, laboratory or further eva