Recombinant Noggin, Mouse (CHO-expressed) - BK0278
Recombinant Noggin, Mouse (CHO-expre Ssed) Catalogue Numbers: BK0278-5, BK0278-25 Sizes: 5μg, 25μg Source: CHO Molecular Weight: 29-31 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE. Biological Activity: ED50< 60 ng/ml, measured in a bioassay using ATDC5 cells in the presence of 10 ng/ml human BMP-4. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAE DLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCF SKRSCSVPEGMVCKPSKSVHLt VLRWRCQRRGGQRCGWIPIQYPIISECKCSC Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant murine Nogginremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Nogginshould be stable up to 1