Saposin B, Human, Recombinant

Saposin B, Human, Recombinant

$600.00
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Saposin B is a small (79 amino acids), non-enzymatic glycosphingolipid activator protein required for the breakdown of cerebroside sulfates (sulfatides) in lysosomes. The protein can extract target lipids from membranes, forming soluble protein-lipid complexes that are recognized by arylsulfatase A. Recombinant human saposin B is produced in E. coli as an N-terminal His-tag fusion and purified by proprietary chromatography techniques with subsequent removal of the tag through a site-specific proteolytic cleavage. Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays.  Saposin B sequence GDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDE Catalog number: SAPB-301 Storage buffer: 25 mM Phosphate Buffer, pH 7.2, 75 mM NaCl, and 50% Glycerol. Concentration: 0.5 - 2.0 mg/mL by A280 (E1% 3.4) (please see protein concentration for speci

Show More Show Less