Saposin C, Human, Recombinant

Human saposin C is small, heat-stable glycoprotein activator of lysosomal glycosphingolipid hydrolases that derive from a single precursor, prosaposin, by proteolytic cleavage. Of the prosaposin derived saposins, saposin C shows the highest amino acid identity/similarity to saposin A. Saposin C is an essential activator for glucocerebrosidase, the enzyme deficient in Gaucher disease (1, 2). It plays role in antigen presentation of lipids through CD1b to human T cells (3). Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays (2). Recombinant human saposin C  is produced in E. coli and purified by proprietary chromatography techniques. Saposin C sequence: SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG Catalog # SAPC-302-1 Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 50% Glycerol. Purity: >90% by Coomassie stai