Saposin D, Human, Recombinant

Saposin D is a sphingolipid activator protein required for the lysosomal breakdown of ceramide to a fatty acid and sphingosine by acid ceramidase. Human saposin D is derived from a precursor, prosaposin, by proteolytic cleavage. Recombinant human saposin D is produced in E. coli and purified by proprietary chromatography techniques. Saposin D sequence: DGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS Catalog # SAPD-301-1 Storage buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 50% Glycerol. Purity: >90% by Coomassie staining Storage is recommended at -20°C for longer periods of time.  International Shipping:  Product requires shipping on ice packs. Please contact info@amidbiosciences.com for shipment estimates This product is for laboratory research use only.