SOS1 Protein, Human, Recombinant
SOS1, also known as son of sevenless homolog 1, is a Ras and Rac guanine nucleotide exchange factor (GEF). SOS1 binds and activates GDP-bound RAS family proteins at its catalytic binding site and in this way promotes exchange of GDP for GTP. Depletion of SOS1 or specific genetic inactivation of its GEF function has been shown to decrease the survival of tumor cells harboring a KRAS mutation (1). The recombinant protein (amino acids 563-1049 of human SOS1) contains two domains, REM (Ras Exchanger Motif) and CDC25 (cell division cycle 25). CDC25 activates Ras and promotes nucleotide exchange on Ras proteins (2). The REM domain contains an activating allosteric site which binds Ras-GTP leading to additional stimulation of the CDC25 domain and potentiating the Ras-GTP exchange stimulated by SOS1. The human SOS1 (Lys563-Thr1049) fragment with a polyhistidine tag at the C-terminus was expressed in E. coli. Sequence of recombinant human SOS1 protein: MKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPIIKA