Recombinant Cat Growth/Differentiation Factor 8 (MSTN)

Recombinant Cat Growth/Differentiation Factor 8 (MSTN)

$946.40
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Cat Growth/Differentiation Factor 8 (MSTN) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb M3WPT7 Target Symbol MSTN Species Felis catus (Cat) (Felis silvestris catus) Expression System E.coli Tag Tag-Free Target Protein Sequence GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Expression Range 19-375aa Protein Length Full Length of Mature Protein Mol. Weight 40.7 kDa Research Area Cancer Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Show More Show Less