Recombinant Dog Growth/Differentiation Factor 8 (MSTN) Protein (His&Myc)

Recombinant Dog Growth/Differentiation Factor 8 (MSTN) Protein (His&Myc)

$680.80
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Dog Growth/Differentiation Factor 8 (MSTN) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb Q6UKZ8 Target Symbol MSTN Species Canis lupus familiaris (Dog) (Canis familiaris) Expression System E.coli Tag N-10His&C-Myc Target Protein Sequence DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Expression Range 267-375aa Protein Length Full Length of Mature Protein Mol. Weight 19.9 kDa Research Area Cancer Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Target Details Target Function Acts specifically as a negative regulator of skeletal muscle growth. Subcellular Location Secreted. Protein Families TGF-beta family Database References KEGG: cfa:403433 STRING: 9615.ENSCAFP00000013840 UniGene: Cfa.136 Gene Functions References Partial myostatin loss may exaggerate selective muscle hypertrophy or atrophy/hypoplasia in dystrophin-deficient dogs and worsen contractures. PMID: 27047655 These results highlight the utility of performance-enhancing polymorphisms, marking the first time a mutation in MSTN has been quantitatively linked to increased athletic performance. PMID: 17530926 Gross muscle hypertrophy in whippet dogs is caused by a mutation in the myostatin gene. PMID: 17651971

Show More Show Less