Recombinant Human Cytomegalovirus Envelope Glycoprotein B (GB) Protein (His&Myc)

Recombinant Human Cytomegalovirus Envelope Glycoprotein B (GB) Protein (His&Myc)

$680.80
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Human Cytomegalovirus Envelope Glycoprotein B (GB) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P06473 Target Symbol GB Synonyms gB; UL55; Envelope glycoprotein B; gB Species Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) Expression System E.coli Tag N-10His&C-Myc Target Protein Sequence TINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRM Expression Range 552-635aa Protein Length Partial Mol. Weight 17.1 kDa Research Area Signal Transduction Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bri

Show More Show Less