Recombinant Human Cytomegalovirus Envelope Glycoprotein L (GL) Protein (His)
Product Overview Description Recombinant Human Cytomegalovirus Envelope Glycoprotein L (GL) Protein (His) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb F5HCH8 Target Symbol GL Species Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) Expression System E.coli Tag N-10His Target Protein Sequence AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR Expression Range 31-278aa Protein Length Full Length of Mature Protein Mol. Weight 31.1 kDa Research Area Microbiology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is