Recombinant Mouse Platelet Factor 4 (PF4) Protein (His-SUMO)

Product Overview Description Recombinant Mouse Platelet Factor 4 (PF4) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb Q9Z126 Target Symbol PF4 Synonyms Pf4; Cxcl4; Scyb4; Platelet factor 4; PF-4; C-X-C motif chemokine 4 Species Mus musculus (Mouse) Expression System E.coli Tag N-6His-SUMO Target Protein Sequence VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES Expression Range 30-105aa Protein Length Full Length of Mature Protein Mol. Weight 24.2kDa Research Area Immunology Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconsti